Beta-site APP-cleaving enzyme 1 (Beta-site APP-cleaving enzyme 1, isoform CRA_d)

UniProt : A0M8W7, P56817, UniProt ID: A0M8W7_HUMAN, BACE1_HUMAN,

Beta-site APP-cleaving enzyme 1 (Beta-site APP-cleaving enzyme 1, isoform CRA_d)

Homo sapiens

MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRQQHDDFADDISLLK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-site APP-cleaving enzyme 1 (Beta-site APP-cleaving enzyme 1, isoform CRA_d) contains a PF00026 domain.

Beta-site APP-cleaving enzyme 1 (Beta-site APP-cleaving enzyme 1, isoform CRA_d) is proteolytically cut by furin (S08.071) cleavage. RLPR-ETDE.