Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c)

UniProt : B1AJZ3, P20333, UniProt ID: B1AJZ3_HUMAN, TNR1B_HUMAN,

Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c)

Homo sapiens

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c) contains a PF00020 domain.

Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c) contains a PF00020 domain.

Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c) contains a PF00020 domain.

Tumor necrosis factor receptor superfamily, member 1B (Tumor necrosis factor receptor superfamily, member 1B, isoform CRA_c) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..