cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a)

UniProt : B2R6M3, P05362, UniProt ID: B2R6M3_HUMAN, ICAM1_HUMAN,

cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a)

Homo sapiens

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a) contains a PF03921 domain.

cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a) is proteolytically cut by gingipain R2 (C25.003) cleavage..

cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a) is proteolytically cut by gingipain R1 (C25.001) cleavage..

cDNA, FLJ93020, highly similar to Homo sapiens intercellular adhesion molecule 1 (CD54), human rhinovirus receptor (ICAM1), mRNA (Intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, isoform CRA_a) is proteolytically cut by gingipain K (C25.002) cleavage..