Chemokine (C-X3-C motif) ligand 1

UniProt : Q91V44, UniProt ID: Q91V44_MOUSE,

Chemokine (C-X3-C motif) ligand 1

Mus musculus

MAPSPLAWLLRLAAFFHLCTLLPGQHLGMTKCEIMCDKMTSRIPVALLIRYQLNQESCGK
RAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNGGKFEKRVDNVTPGITLATRG
LSPSALTKPESATLEDLALELTTISQEARGTMGTSQEPPAAVTGSSLSTSEAQDAGLTAK
PQSIGSFEAADISTTVWPSPAVYQSGSSSWAEEKATESPSTTAPSPQVSTTSPSTPEENV
GSEGQPPWVQGQDLSPEKSLGSEEINPVHTDNFQERGPGNTVHPSVAPISSEETPSPELV
ASGSQAPKIEEPIHATADPQKLSVLITPVPDTQAATRRQAVGLLAFLGLLFCLGVAMFAY
QSLQGCPRKMAGEMVEGLRYVPRSCGSNSYVLVPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chemokine (C-X3-C motif) ligand 1 contains a PF00048 domain.

Chemokine (C-X3-C motif) ligand 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. QHLG-MTKC.

Chemokine (C-X3-C motif) ligand 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. QAAA-LTKN.