Isoform 3 of Collagen alpha-1(XVIII) chain

UniProt : P39061, UniProt ID: P39061-2,

Isoform 3 of Collagen alpha-1(XVIII) chain

Mus musculus

MAPRWHLLDVLTSLVLLLVARVSWAEPENVAEEVGLLQLLGDPLPEKISQIDDPHVGPAY
IFGPDSNSGQVAQYHFPKLFFRDFSLLFHVRPATEAAGVLFAITDAAQVVVSLGVKLSEV
RDGQQNISLLYTEPGASQTQTGASFRLPAFVGQWTHFALSVDGGSVALYVDCEEFQRVPF
ARASQGLELERGAGLFVGQAGTADPDKFQGMISELKVRKTPRVSPVHCLDEEDDDEDRAS
GDFGSGFEESSKSHKEDTSLLPGLPQPPPVTSPPLAGGSTTEDPRTEETEEDAAVDSIGA
ETLPGTGSSGAWDEAIQNPGRGLIKGGMKGQKGEPGAQGPPGPAGPQGPAGPVVQSPNSQ
PVPGAQGPPGPQGPPGKDGTPGRDGEPGDPGEDGRPGDTGPQGFPGTPGDVGPKGEKGDP
GIGPRGPPGPPGPPGPSFRQDKLTFIDMEGSGFSGDIESLRGPRGFPGPPGPPGVPGLPG
EPGRFGINGSYAPGPAGLPGVPGKEGPPGFPGPPGPPGPPGKEGPPGVAGQKGSVGDVGI
PGPKGSKGDLGPIGMPGKSGLAGSPGPVGPPGPPGPPGPPGPGFAAGFDDMEGSGIPLWT
TARSSDGLQGPPGSPGLKGDPGVAGLPGAKGEVGADGAQGIPGPPGREGAAGSPGPKGEK
GMPGEKGNPGKDGVGRPGLPGPPGPPGPVIYVSSEDKAIVSTPGPEGKPGYAGFPGPAGP
KGDLGSKGEQGLPGPKGEKGEPGTIFSPDGRALGHPQKGAKGEPGFRGPPGPYGRPGHKG
EIGFPGRPGRPGTNGLKGEKGEPGDASLGFSMRGLPGPPGPPGPPGPPGMPIYDSNAFVE
SGRPGLPGQQGVQGPSGPKGDKGEVGPPGPPGQFPIDLFHLEAEMKGDKGDRGDAGQKGE
RGEPGAPGGGFFSSSVPGPPGPPGYPGIPGPKGESIRGPPGPPGPQGPPGIGYEGRQGPP
GPPGPPGPPSFPGPHRQTVSVPGPPGPPGPPGPPGAMGASAGQVRIWATYQTMLDKIREV
PEGWLIFVAEREELYVRVRNGFRKVLLEARTALPRGTGNEVAALQPPLVQLHEGSPYTRR
EYSYSTARPWRADDILANPPRLPDRQPYPGVPHHHSSYVHLPPARPTLSLAHTHQDFQPV
LHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSV
PIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRR
LMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01392 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF06482 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF06121 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain contains a PF01391 domain.

Isoform 3 of Collagen alpha-1(XVIII) chain is proteolytically cut by cathepsin L (C01.032) cleavage. LSLA-HTHQ.