Poly [ADP-ribose] polymerase 2

UniProt : O88554, UniProt ID: PARP2_MOUSE,

Poly [ADP-ribose] polymerase 2

Mus musculus

MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Poly [ADP-ribose] polymerase 2 contains a PF02877 domain.

Poly [ADP-ribose] polymerase 2 contains a PF05406 domain.

Poly [ADP-ribose] polymerase 2 contains a PF00644 domain.

Poly [ADP-ribose] polymerase 2 is proteolytically cut by caspase-8 (C14.009) cleavage. LEDD-AQRN.

Poly [ADP-ribose] polymerase 2 is proteolytically cut by caspase-8 (C14.009) cleavage. LQMD-YAAS.