Secretin

UniProt : P09683, UniProt ID: SECR_HUMAN,

Secretin

Homo sapiens

MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ
DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP
R

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Secretin contains a PF00123 domain.

Secretin is proteolytically cut by meprin beta subunit (M12.004) cleavage. RHSD-GTFT.

Secretin is proteolytically cut by meprin beta subunit (M12.004) cleavage. RRHS-DGTF.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RLLQ-GLVG.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. ARLQ-RLLQ.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RLQR-LLQG.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. LREG-ARLQ.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. EGAR-LQRL.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SRLR-EGAR.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RLRE-GARL.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SELS-RLRE.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. ELSR-LREG.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SDGT-FTSE.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. DGTF-TSEL.

Secretin is proteolytically cut by meprin alpha subunit (M12.002) cleavage. GTFT-SELS.

Secretin is proteolytically cut by (S9G.073) cleavage. RLQR-LLQG.

Secretin is proteolytically cut by (S9G.073) cleavage. EGAR-LQRL.