Chemokine (C-X-C motif) ligand 2

UniProt : P10889, Q3U1J5, UniProt ID: MIP2_MOUSE, Q3U1J5_MOUSE,

Chemokine (C-X-C motif) ligand 2

Mus musculus

MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGP
HCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chemokine (C-X-C motif) ligand 2 contains a PF00048 domain.

Chemokine (C-X-C motif) ligand 2 is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. KIIQ-KILN.