cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA

UniProt : B2R7G0, P04004, UniProt ID: B2R7G0_HUMAN, VTNC_HUMAN,

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA

Homo sapiens

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA contains a PF01033 domain.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA contains a PF00045 domain.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA contains a PF00045 domain.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA contains a PF00045 domain.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA contains a PF00045 domain.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. KPEG-IDSR.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. TRGD-VFTM.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VALA-DQES.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. KPEG-IDSR.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. TRGD-VFTM.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VALA-DQES.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. QVTR-GDVF.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. KLIR-DVWG.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. KPEG-IDSR.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. TRGD-VFTM.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VALA-DQES.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. QVTR-GDVF.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by kallikrein hK14 (S01.029) cleavage. KLIR-DVWG.

cDNA, FLJ93428, highly similar to Homo sapiens vitronectin (serum spreading factor, somatomedin B, complement S-protein) (VTN), mRNA is proteolytically cut by plasmin (S01.233) cleavage. KGYR-SQRG.