cDNA, FLJ92321, Homo sapiens myosin, light polypeptide 3, alkali; ventricular,skeletal, slow (MYL3), mRNA (Myosin, light polypeptide 3, alkali; ventricular, skeletal, slow, isoform CRA_a)

UniProt : B2R534, P08590, UniProt ID: B2R534_HUMAN, MYL3_HUMAN,

cDNA, FLJ92321, Homo sapiens myosin, light polypeptide 3, alkali; ventricular,skeletal, slow (MYL3), mRNA (Myosin, light polypeptide 3, alkali; ventricular, skeletal, slow, isoform CRA_a)

Homo sapiens

MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92321, Homo sapiens myosin, light polypeptide 3, alkali; ventricular,skeletal, slow (MYL3), mRNA (Myosin, light polypeptide 3, alkali; ventricular, skeletal, slow, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DFVE-GLRV.