Myosin light chain 1, skeletal muscle isoform

UniProt : P02600, UniProt ID: MLE1_RAT,

Myosin light chain 1, skeletal muscle isoform

Rattus norvegicus

MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRT
GECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKD
QGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYE
AFVKHIMSV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myosin light chain 1, skeletal muscle isoform contains a PF00036 domain.

Myosin light chain 1, skeletal muscle isoform contains a PF00036 domain.

Myosin light chain 1, skeletal muscle isoform is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. CINY-EAFV.