Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA)

UniProt : A0N0N7, P78423, UniProt ID: A0N0N7_HUMAN, X3CL1_HUMAN,

Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA)

Homo sapiens

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA) contains a PF00048 domain.

Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Chemokine (C-X3-C motif) ligand 1 (cDNA, FLJ94424, Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..