Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA)

UniProt : P06396, Q5T0I2, UniProt ID: GELS_HUMAN, Q5T0I2_HUMAN,

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA)

Homo sapiens

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) contains a PF00626 domain.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by caspase-9 (C14.010) cleavage. DQTD-GLGL.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by caspase-7 (C14.004) cleavage. DQTD-GLGL.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by caspase-7 (C14.004) cleavage. DQTD-GLGL.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DQTD-GLGL.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RPNS-MVVE.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HIAN-VERV.

Gelsolin (Amyloidosis, Finnish type) (Gelsolin (Amyloidosis, Finnish type), isoform CRA_c) (cDNA, FLJ96557, Homo sapiens gelsolin (amyloidosis, Finnish type) (GSN), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AMAA-QHGM.