Amiloride-sensitive sodium channel subunit gamma

UniProt : Q9WU39, UniProt ID: SCNNG_MOUSE,

Amiloride-sensitive sodium channel subunit gamma

Mus musculus

MAPGEKIKAKIKKNLPVRGPQAPTIKDLMHWYCLNTNTHGCRRIVVSRGRLRRLLWIAFT
LTAVALIIWQCALLVFSFYTVSVSIKVHFQKLDFPAVTICNINPYKYSAVSDLLTDLDSE
TKQALLSLYGVKDVLDSTPRKRREAGSMRSTWEGTPPRFLNLIPLLVFNENEKGKARDFF
TGRKRKISGKIIHKASNVMHVHESKKLVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHY
MNIMAQVPLEKKINMSYSAEELLVTCFFDGMSCDARNFTLFHHPMYGNCYTFNNRENATI
LSTSMGGSEYGLQVILYINEDEYNPFLVSSTGAKVLVHQQNEYPFIEDVGTEIETAMSTS
IGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQ
PLPPAANYCNYQQHPNWMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSE
ASEKWLLNVLTWDQSQQINKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQ
LGLWMSCSVVCVIEIIEVFFIDFFSIIARRQWQKAKDWWARRRTPPSTETPSSQQGQDNP
ALDTDDDLPTFTSAMRLPPAPEAPVPGTPPPRYNTLRLDSAFSSQLTDTQLTNEF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amiloride-sensitive sodium channel subunit gamma contains a PF00858 domain.

Amiloride-sensitive sodium channel subunit gamma is proteolytically cut by prostasin (S01.159) cleavage. RKRK-ISGK.

Amiloride-sensitive sodium channel subunit gamma is proteolytically cut by furin (S08.071) cleavage. RKRR-EAGS.