Putative uncharacterized protein
|
UniProt : P01033, Q6FGX5, UniProt ID: Q6FGX5_HUMAN, TIMP1_HUMAN, Putative uncharacterized protein Homo sapiens MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK GFQSRHLACLPREPGLCTWQSLRSQIA The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Putative uncharacterized protein contains a PF00965 domain.
Putative uncharacterized protein is proteolytically cut by neutrophil elastase (S01.131) cleavage. MESV-CGYF.