Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b)

UniProt : Q5T022, UniProt ID: Q5T022_HUMAN,

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b)

Homo sapiens

MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWAAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINS
QQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPID
RVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNR
YANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWE
QRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIV
IDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNL
YAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMR
YEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00041 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00102 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF00102 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF07679 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF07679 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) contains a PF07679 domain.

Protein tyrosine phosphatase, receptor type, F (Protein tyrosine phosphatase, receptor type, F, isoform CRA_b) is proteolytically cut by ADAM17 peptidase () cleavage..