Bacteriocin lactocin-705

UniProt : P80959, UniProt ID: LC70_LACPA,

Bacteriocin lactocin-705

Lactobacillus paracasei

GMSGYIQGIPDFLKGYLHGISAANKHKKGRL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin lactocin-705 contains a PF08109 domain.

Bacteriocin lactocin-705 is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. TIGG-GMSG.