Syndecan
|
UniProt : P31431, Q6FGN3, UniProt ID: Q6FGN3_HUMAN, SDC4_HUMAN, Syndecan Homo sapiens MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY DLGKKPIYKKAPTNEFYA The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Syndecan contains a PF01034 domain.
Syndecan is proteolytically cut by plasmin (S01.233) cleavage. VIPK-RISP.
Syndecan is proteolytically cut by thrombin (S01.217) cleavage. VIPK-RISP.
Syndecan is proteolytically cut by plasmin (S01.233) cleavage. VSNK-VSMS.