Syndecan

UniProt : P31431, Q6FGN3, UniProt ID: Q6FGN3_HUMAN, SDC4_HUMAN,

Syndecan

Homo sapiens

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syndecan contains a PF01034 domain.

Syndecan is proteolytically cut by plasmin (S01.233) cleavage. VIPK-RISP.

Syndecan is proteolytically cut by thrombin (S01.217) cleavage. VIPK-RISP.

Syndecan is proteolytically cut by plasmin (S01.233) cleavage. VSNK-VSMS.