Ephrin-A2
|
UniProt : O43921, UniProt ID: EFNA2_HUMAN, Ephrin-A2 Homo sapiens MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Ephrin-A2 contains a PF00812 domain.
Ephrin-A2 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..