Syndecan

UniProt : O35988, Q3U5S6, UniProt ID: Q3U5S6_MOUSE, SDC4_MOUSE,

Syndecan

Mus musculus

MAPACLLAPLLLLLLGGFPLVPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFE
LSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSD
VGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syndecan contains a PF01034 domain.

Syndecan is proteolytically cut by caspase-1 (C14.001) cleavage. IRET-EVID.