Hatching enzyme

UniProt : P22757, UniProt ID: HE_PARLI,

Hatching enzyme

Paracentrotus lividus

MANSGLILLVMFMIHVTTVHNVPLPSTAPSIITQLSDITTSIIEEDAFGLTTPTTGLLTP
VSENDSDDDGDDITTIQTTTSSSQTVISGVVVEEGVHESNVEILKAHLEKFGYTPPGSTF
GEANLNYTSAILDFQEHGGINQTGILDADTAELLSTPRCGVPDVLPFVTSSITWSRNQPV
TYSFGALTSDLNQNDVKDEIRRAFRVWDDVSGLSFREVPDTTSVDIRIKFGSYDHGDGIS
FDGRGGVLAHAFLPRNGDAHFDDSETWTEGTRSGTNLFQVAAHEFGHSLGLYHSTVRSAL
MYPYYQGYVPNFRLDNDDIAGIRSLYGSNSGSGTTTTTRRPTTTRATTTRRTTTTRATTT
RATTTTTTSPSRPSPPRRACSGSFDAVVRDSSNRIYALTGPYFWQLDQPSPSWGLVSNRF
GFGLPQNIDASFQRGVVTYFFSECYYYYQTSTQRNFPRIPVNRKWVGLPCNIDAVYRSSR
GPTYFFKDSFVYKFNSNNRLQRRTRISSLFNDVPSALHDGVEAVVRADRNYIHFYRDGRY
YRMTDYGRQFVNFPNGLPYSDVIESVIPQCRGRSLSYESEGCSNSSE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hatching enzyme contains a PF00045 domain.

Hatching enzyme contains a PF00045 domain.

Hatching enzyme contains a PF00045 domain.

Hatching enzyme contains a PF01471 domain.

Hatching enzyme contains a PF00413 domain.

Hatching enzyme contains a PF00045 domain.

Hatching enzyme is proteolytically cut by () cleavage. DVLP-FVTS.

Hatching enzyme is proteolytically cut by () cleavage. HVTT-VHNV.