Major prion protein

UniProt : P04925, Q4FJQ7, UniProt ID: PRIO_MOUSE, Q4FJQ7_MOUSE,

Major prion protein

Mus musculus

MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPH
GGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAV
VGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVN
ITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPP
VILLISFLIFLIVG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Major prion protein contains a PF00377 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein is proteolytically cut by calpain-1 (C02.001) cleavage. GGGW-GQGG.