Major prion protein

UniProt : P04156, Q53YK7, UniProt ID: PRIO_HUMAN, Q53YK7_HUMAN,

Major prion protein

Homo sapiens

MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF03991 domain.

Major prion protein contains a PF00377 domain.

Major prion protein is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. NMKH-MAGA.

Major prion protein is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. NMKH-MAGA.

Major prion protein is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. NMKH-MAGA.