BlaI

UniProt : Q6UB84, UniProt ID: Q6UB84_STAAU,

BlaI

Staphylococcus aureus

MANKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKR
YKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDIL
NDISKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

BlaI contains a PF03965 domain.

BlaI is proteolytically cut by BlaR1 peptidase (M56.001) cleavage. LVLN-FAKN.