50 kDa hatching enzyme

UniProt : P91953, UniProt ID: HE_HEMPU,

50 kDa hatching enzyme

Hemicentrotus pulcherrimus

MANFCLIFAAVFLTRLTTVLNTPISVTFGPTQLTDITKLVSETGDDFGLTTPRSAILTTV
SEDDSDDDDGGESVEDTTILQTTTSSEIVISGIVVDEDIDESKVVKLKANLEQFGYVPLG
STFGEANINYTSAILEYQQNGGINQTGILDAETAALLDTPRCGVPDILPYVTGGIAWPRN
VAVTYSFGTLSNDLSQTAIKNELRRAFQVWDDVSSLTFREVVDSSSVDIRIKFGSYEHGD
GISFDGQGGVLAHAFLPRNGDAHFDDSERWTIGTNSGTNLFQVAAHEFGHSLGLYHSDVQ
SALMYPYYRGYNPNFNLDRDDIAGITSLYGRNTGSTTTTTRRPTITRTTTRRTTTRRTTT
QLATTQTTTIRPPTYPTPPRQACTGSFDAVIKDNSDRIYALAGRYYWRLDQASPSWGVVR
NRFGFDLPENVDASFQNGIFSYFFSGCYYYYQTSTRRRFPRTPFNRRWVGLPCDIDAVYK
SGDSGTTYFFKGRFVYKFSSSNQLQRRSPISSYFRNTPYALRDGVEAVVRVDDVYLHFYR
DGRYYRMIESTKQFVNFPNGLSYRDVIDTLIPQCRSLNLSVEIESCSNSSE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

50 kDa hatching enzyme contains a PF00045 domain.

50 kDa hatching enzyme contains a PF00045 domain.

50 kDa hatching enzyme contains a PF01471 domain.

50 kDa hatching enzyme contains a PF00413 domain.

50 kDa hatching enzyme contains a PF00045 domain.

50 kDa hatching enzyme contains a PF00045 domain.

50 kDa hatching enzyme is proteolytically cut by envelysin (M10.010) cleavage. CYYY-YQTS.

50 kDa hatching enzyme is proteolytically cut by envelysin (M10.010) cleavage. SSNQ-LQRR.