Cldn1 protein

UniProt : O88551, Q4FJV3, UniProt ID: CLD1_MOUSE, Q4FJV3_MOUSE,

Cldn1 protein

Mus musculus

MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV
IGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGV
LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cldn1 protein contains a PF00822 domain.

Cldn1 protein is proteolytically cut by peptidase 1 (C01.073) cleavage. FDSL-LNLN.

Cldn1 protein is proteolytically cut by peptidase 1 (C01.073) cleavage. AWYG-NRIV.

Cldn1 protein is proteolytically cut by peptidase 1 (C01.073) cleavage. SLLN-LNST.