cDNA, FLJ94059, Homo sapiens RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)(RAD51), transcript variant 1, mRNA (RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform CRA_d)

UniProt : B2R8T6, Q06609, UniProt ID: B2R8T6_HUMAN, RAD51_HUMAN,

cDNA, FLJ94059, Homo sapiens RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)(RAD51), transcript variant 1, mRNA (RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform CRA_d)

Homo sapiens

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94059, Homo sapiens RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)(RAD51), transcript variant 1, mRNA (RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform CRA_d) contains a PF08423 domain.

cDNA, FLJ94059, Homo sapiens RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)(RAD51), transcript variant 1, mRNA (RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage. AQVD-GAAM.

cDNA, FLJ94059, Homo sapiens RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)(RAD51), transcript variant 1, mRNA (RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage. DVLD-NVAY.