Insulin

UniProt : P01317, UniProt ID: INS_BOVIN,

Insulin

Bos taurus

MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin contains a PF00049 domain.

Insulin is proteolytically cut by aminopeptidase N (M01.005) cleavage..

Insulin is proteolytically cut by aminopeptidase N (M01.005) cleavage..

Insulin is proteolytically cut by (A9G.010) cleavage. EALY-LVCG.

Insulin is proteolytically cut by (A9G.010) cleavage. LVEA-LYLV.