Insulin
|
Insulin Bos taurus MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Insulin contains a PF00049 domain.
Insulin is proteolytically cut by aminopeptidase N (M01.005) cleavage..
Insulin is proteolytically cut by aminopeptidase N (M01.005) cleavage..
Insulin is proteolytically cut by (A9G.010) cleavage. EALY-LVCG.
Insulin is proteolytically cut by (A9G.010) cleavage. LVEA-LYLV.