Insulin

UniProt : P01308, UniProt ID: INS_HUMAN,

Insulin

Homo sapiens

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin contains a PF00049 domain.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. GFFY-TPKT.

Insulin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. GFFY-TPKT.

Insulin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EALY-LVCG.

Insulin is proteolytically cut by periodontain (C10.003) cleavage..

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. GFFY-TPKT.

Insulin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EALY-LVCG.

Insulin is proteolytically cut by periodontain (C10.003) cleavage..

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. EALY-LVCG.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. ALYL-VCGE.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VEAL-YLVC.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. AAAF-VNQH.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. GSHL-VEAL.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. RGFF-YTPK.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. ERGF-FYTP.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by cathepsin D (A01.009) cleavage. ERGF-FYTP.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. FVNQ-HLCG.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. LCGS-HLVE.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. EALY-LVCG.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. GERG-FFYT.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. PKTR-REAE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. PKTR-REAE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. KTRR-EAED.

Insulin is proteolytically cut by yapsin 1 (A01.030) cleavage. KTRR-EAED.

Insulin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. KTRR-EAED.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GERG-FFYT.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EALY-LVCG.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. CGSH-LVEA.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SICS-LYQL.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SLYQ-LENY.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVCG-ERGF.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. YQLE-NYCN.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AFVN-QHLC.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VNQH-LCGS.

Insulin is proteolytically cut by endosomal acidic insulinase (EAI) () cleavage. ERGF-FYTP.

Insulin is proteolytically cut by endosomal acidic insulinase (EAI) () cleavage. RGFF-YTPK.

Insulin is proteolytically cut by PC2, PC3 () cleavage. LQKR-GIVE.

Insulin is proteolytically cut by () cleavage. TRRE-AEDL.

Insulin is proteolytically cut by () cleavage. RREA-EDLQ.

Insulin is proteolytically cut by () cleavage. EDLQ-VGQV.

Insulin is proteolytically cut by () cleavage. QVGQ-VELG.

Insulin is proteolytically cut by () cleavage. SLQP-LALE.

Insulin is proteolytically cut by () cleavage. LQPL-ALEG.

Insulin is proteolytically cut by () cleavage. QPLA-LEGS.

Insulin is proteolytically cut by () cleavage. LEGS-LQKR.

Insulin is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. GFFY-TPKT.

Insulin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. EALY-LVCG.

Insulin is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EALY-LVCG.

Insulin is proteolytically cut by periodontain (C10.003) cleavage..

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. EALY-LVCG.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. ALYL-VCGE.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VEAL-YLVC.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. AAAF-VNQH.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. GSHL-VEAL.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. RGFF-YTPK.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. ERGF-FYTP.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by cathepsin E (A01.010) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by cathepsin D (A01.009) cleavage. ERGF-FYTP.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. FVNQ-HLCG.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. LCGS-HLVE.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. EALY-LVCG.

Insulin is proteolytically cut by cathepsin B (C01.060) cleavage. GERG-FFYT.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. PKTR-REAE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. PKTR-REAE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. KTRR-EAED.

Insulin is proteolytically cut by yapsin 1 (A01.030) cleavage. KTRR-EAED.

Insulin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LQKR-GIVE.

Insulin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. KTRR-EAED.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GERG-FFYT.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. EALY-LVCG.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. CGSH-LVEA.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SICS-LYQL.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SLYQ-LENY.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVCG-ERGF.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. YQLE-NYCN.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AFVN-QHLC.

Insulin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VNQH-LCGS.

Insulin is proteolytically cut by endosomal acidic insulinase (EAI) () cleavage. ERGF-FYTP.

Insulin is proteolytically cut by endosomal acidic insulinase (EAI) () cleavage. RGFF-YTPK.

Insulin is proteolytically cut by PC2, PC3 () cleavage. LQKR-GIVE.

Insulin is proteolytically cut by () cleavage. TRRE-AEDL.

Insulin is proteolytically cut by () cleavage. RREA-EDLQ.

Insulin is proteolytically cut by () cleavage. EDLQ-VGQV.

Insulin is proteolytically cut by () cleavage. QVGQ-VELG.

Insulin is proteolytically cut by () cleavage. SLQP-LALE.

Insulin is proteolytically cut by () cleavage. LQPL-ALEG.

Insulin is proteolytically cut by () cleavage. QPLA-LEGS.

Insulin is proteolytically cut by () cleavage. LEGS-LQKR.

Insulin is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage. HLVE-ALYL.

Insulin is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage. VCGE-RGFF.

Insulin is proteolytically cut by ADAM19 peptidase (M12.209) cleavage. LVEA-LYLV.

Insulin is proteolytically cut by kallikrein hK7 (S01.300) cleavage. NQHL-CGSH.

Insulin is proteolytically cut by kallikrein hK7 (S01.300) cleavage. ALYL-VCGE.

Insulin is proteolytically cut by kallikrein hK7 (S01.300) cleavage. RGFF-YTPK.

Insulin is proteolytically cut by kallikrein hK7 (S01.300) cleavage. GFFY-TPKT.