Insulin II

UniProt : P01326, Q5EEX1, UniProt ID: INS2_MOUSE, Q5EEX1_MOUSE,

Insulin II

Mus musculus

MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin II contains a PF00049 domain.

Insulin II is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. QQKR-GIVD.

Insulin II is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. MSRR-EVED.