Insulin-2
|
Insulin-2 Rattus norvegicus MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED PQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Insulin-2 contains a PF00049 domain.
Insulin-2 is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RQKR-GIVD.
Insulin-2 is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RQKR-GIVD.