Insulin-2

UniProt : P01323, UniProt ID: INS2_RAT,

Insulin-2

Rattus norvegicus

MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-2 contains a PF00049 domain.

Insulin-2 is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RQKR-GIVD.

Insulin-2 is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RQKR-GIVD.