Tropomodulin-3

UniProt : Q9JHJ0, UniProt ID: TMOD3_MOUSE,

Tropomodulin-3

Mus musculus

MALPFRKDLGDYKDLDEDELLGKLSESELKQLETVLDDLDPENALLPAGFRQKNQTSKSA
TGPFDRERLLSYLEKQALEHKDRDDYVPYTGEKKGKIFIPKQKPAQTLTEETISLDPELE
EALTSASDTELCDLAAILGMHNLIADTPFCDVLGSSNGVNQERFPNVVKGEKILPVFDEP
PNPTNVEESLKRIRENDARLVEVNLNNIKNIPIPTLKDFAKTLEANTHVKHFSLAATRSN
DPVAVAFADMLKVNKTLKSLNMESNFITGAGVLALIDALRDNETLMELKIDNQRQQLGTS
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRIEGDHQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tropomodulin-3 contains a PF03250 domain.

Tropomodulin-3 is proteolytically cut by caspase-1 (C14.001) cleavage. TPFC-DVLG.