Sjoegren syndrome/scleroderma autoantigen 1

UniProt : O60232, UniProt ID: SSA27_HUMAN,

Sjoegren syndrome/scleroderma autoantigen 1

Homo sapiens

MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL
CGLIRACAEALRSLQQLQH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sjoegren syndrome/scleroderma autoantigen 1 contains a PF06677 domain.

Sjoegren syndrome/scleroderma autoantigen 1 is proteolytically cut by caspase () cleavage. SDVD-KDNP.