Sjoegren syndrome/scleroderma autoantigen 1
|
UniProt : O60232, UniProt ID: SSA27_HUMAN, Sjoegren syndrome/scleroderma autoantigen 1 Homo sapiens MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVP RPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL CGLIRACAEALRSLQQLQH The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Sjoegren syndrome/scleroderma autoantigen 1 contains a PF06677 domain.
Sjoegren syndrome/scleroderma autoantigen 1 is proteolytically cut by caspase () cleavage. SDVD-KDNP.