Homo sapiens

MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGWQLTSGPNQEQVSPLTLLKLGNQEPGGQ
TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. AMSR-MSLS.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. TSIA-MSRM.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FLQS-LKGF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QVSP-LTLL.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. SIAM-SRMS.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APRE-LKEQ.

is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. EAAA-ATSI.

is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. AAAT-SIAM.