Alpha-1-acid glycoprotein

UniProt : Q3SZR3, UniProt ID: A1AG_BOVIN,

Alpha-1-acid glycoprotein

Bos taurus

MALLWALAVLSHLPLLDAQSPECANLMTVAPITNATMDLLSGKWFYIGSAFRNPEYNKSA
RAIQAAFFYLEPRHAEDKLITREYQTIEDKCVYNCSFIKIYRQNGTLSKVESDREHFVDL
LLSKHFRTFMLAASWNGTKNVGVSFYADKPEVTQEQKKEFLDVIKCIGIQESEIIYTDEK
KDACGPLEKQHEEERKKETEAS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-1-acid glycoprotein contains a PF00061 domain.

Alpha-1-acid glycoprotein is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..