Alpha-1-acid glycoprotein
|
UniProt : Q3SZR3, UniProt ID: A1AG_BOVIN, Alpha-1-acid glycoprotein Bos taurus MALLWALAVLSHLPLLDAQSPECANLMTVAPITNATMDLLSGKWFYIGSAFRNPEYNKSA RAIQAAFFYLEPRHAEDKLITREYQTIEDKCVYNCSFIKIYRQNGTLSKVESDREHFVDL LLSKHFRTFMLAASWNGTKNVGVSFYADKPEVTQEQKKEFLDVIKCIGIQESEIIYTDEK KDACGPLEKQHEEERKKETEAS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Alpha-1-acid glycoprotein contains a PF00061 domain.
Alpha-1-acid glycoprotein is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..