Glycoprotein 1b, alpha polypeptide

UniProt : A2CFB8, O35930, UniProt ID: A2CFB8_MOUSE, GP1BA_MOUSE,

Glycoprotein 1b, alpha polypeptide

Mus musculus

MALLILLFLLPSPLHSQHTCSISKVTSLLEVNCENKKLTALPADLPADTGILHLGENQLG
TFSTASLVHFTHLTYLYLDRCELTSLQTNGKLIKLENLDLSHNNLKSLPSLGWALPALTT
LDVSFNKLGSLSPGVLDGLSQLQELYLQNNDLKSLPPGLLLPTTKLKKLNLANNKLRELP
SGLLDGLEDLDTLYLQRNWLRTIPKGFFGTLLLPFVFLHANSWYCDCEILYFRHWLQENA
NNVYLWKQGVDVKDTTPNVASVRCANLDNAPVYSYPGKGCPTSSGDTDYDDYDDIPDVPA
TRTEVKFSTNTKVHTTHWSLLAAAPSTSQDSQMISLPPTHKPTKKQSTFIHTQSPGFTTL
PETMESNPTFYSLKLNTVLIPSPTTLEPTSTQATPEPNIQPMLTTSTLTTPEHSTTPVPT
TTILTTPEHSTIPVPTTAILTTPKPSTIPVPTTATLTTLEPSTTPVPTTATLTTPEPSTT
LVPTTATLTTPEHSTTPVPTTATLTTPEHSTTPVPTTATLTTPEPSTTLTNLVSTISPVL
TTTLTTPESTPIETILEQFFTTELTLLPTLESTTTIIPEQNSFLNLPEVALVSSDTSESS
PFLNSDFCCFLPLGFYVLGLLWLLFASVVLILLLTWTWHVTPHSLDMEQSAALATSTHTT
SLEVQRARQVTMPRAWLLFLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQD
LLGTVGIRYSGHSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glycoprotein 1b, alpha polypeptide contains a PF01462 domain.

Glycoprotein 1b, alpha polypeptide contains a PF00560 domain.

Glycoprotein 1b, alpha polypeptide contains a PF00560 domain.

Glycoprotein 1b, alpha polypeptide contains a PF00560 domain.

Glycoprotein 1b, alpha polypeptide contains a PF00560 domain.

Glycoprotein 1b, alpha polypeptide contains a PF00560 domain.

Glycoprotein 1b, alpha polypeptide is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..