Ribonuclease pancreatic

UniProt : P61823, UniProt ID: RNAS1_BOVIN,

Ribonuclease pancreatic

Bos taurus

MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ribonuclease pancreatic contains a PF00074 domain.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. TNCY-QSYS.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. SYST-MSIT.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. VNTF-VHES.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. GSSK-YPNC.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. QHMD-SSTS.

Ribonuclease pancreatic is proteolytically cut by syncephapepsin (A01.042) cleavage. PNCA-YKTT.