Tobacco etch virus

MALIFGTVNANILKEVFGGARMACVTSAHMAGANGSILKKAEETSRAIMHKPVIFGEDYI
TEADLPYTPLHLEVDAEMERMYYLGRRALTHGKRRKVSVNNKRNRRRKVAKTYVGRDSIV
EKIVVPHTERKVDTTAAVEDICNEATTQLVHNSMPKRKKQKNFLPATSLSNVYAQTWSIV
RKRHMQVEIISKKSVRARVKRFEGSVQLFASVRHMYGERKRVDLRIDNWQQETLLDLAKR
FKNERVDQSKLTFGSSGLVLRQGSYGPAHWYRHGMFIVRGRSDGMLVDARAKVTFAVCHS
MTHYSDKSISEAFFIPYSKKFLELRPDGISHECTRGVSVERCGEVAAILTQALSPCGKIT
CKRCMVETPDIVEGESGESVTNQGKLLAMLKEQYPDFPMAEKLLTRFLQQKSLVNTNLTA
CVSVKQLIGDRKQAPFTHVLAVSEILFKGNKLTGADLEEASTHMLEIARFLNNRTENMRI
GHLGSFRNKISSKAHVNNALMCDNQLDQNGNFIWGLRGAHAKRFLKGFFTEIDPNEGYDK
YVIRKHIRGSRKLAIGNLIMSTDFQTLRQQIQGETIERKEIGNHCISMRNGNYVYPCCCV
TLEDGKAQYSDLKHPTKRHLVIGNSGDSKYLDLPVLNEEKMYIANEGYCYMNIFFALLVN
VKEEDAKDFTKFIRDTIVPKLGAWPTMQDVATACYLLSILYPDVLRAELPRILVDHDNKT
MHVLDSYGSRTTGYHMLKMNTTSQLIEFVHSGLESEMKTYNVGGMNRDVVTQGAIEMLIK
SIYKPHLMKQLLEEEPYIIVLAIVSPSILIAMYNSGTFEQALQMWLPNTMRLANLAAILS
ALAQKLTLADLFVQQRNLINEYAQVILDNLIDGVRVNHSLSLAMEIVTIKLATQEMDMAL
REGGYAVTSEKVHEMLEKNYVKALKDAWDELTWLEKFSAIRHSRKLLKFGRKPLIMKNTV
DCGGHIDLSVKSLFKFHLELLKGTISRAVNGGARKVRVAKNAMTKGVFLKIYSMLPDVYK
FITVSSVLSLLLTFLFQIDCMIRAHREAKVAAQLQKESEWDNIINRTFQYSKLENPIGYR
STAEERLQSEHPEAFEYYKFCIGKEDLVEQAKQPEIAYFEKIIAFITLVLMAFDAERSDG
VFKILNKFKGILSSTEREIIYTQSLDDYVTTFDDNMTINLELNMDELHKTSLPGVTFKQW
WNNQISRGNVKPHYRTEGHFMEFTRDTAASVASEISHSPARDFLVRGAVGSGKSTGLPYH
LSKRGRVLMLEPTRPLTDNMHKQLRSEPFNCFPTLRMRGKSTFGSSPITVMTSGFALHHF
ARNIAEVKTYDFVIIDECHVNDASAIAFRNLLFEHEFEGKVLKVSATPPGREVEFTTQFP
VKLKIEEALSFQEFVSLQGTGANADVISCGDNILVYVASYNDVDSLGKLLVQKGYKVSKI
DGRTMKSGGTEIITEGTSVKKHFIVATNIIENGVTIDIDVVVDFGTKVVPVLDVDNRAVQ
YNKTVVSYGERIQKLGRVGRHKEGVALRIGQTNKTLVEIPEMVATEAAFLCFMYNLPVTT
QSVSTTLLENATLLQARTMAQFELSYFYTINFVRFDGSMHPVIHDKLKRFKLHTCETFLN
KLAIPNKGLSSWLTSGEYKRLGYIAEDAGIRIPFVCKEIPDSLHEEIWHIVVAHKGDSGI
GRLTSVQAAKVVYTLQTDVHSIARTLACINRRIADEQMKQSHFEAATGRAFSFTNYSIQS
IFDTLKANYATKHTKENIAVLQQAKDQLLEFSNLAKDQDVTGIIQDFNHLETIYLQSDSE
VAKHLKLKSHWNKSQITRDIIIALSVLIGGGWMLATYFKDKFNEPVYFQGKKNQKHKLKM
REARGARGQYEVAAEPEALEHYFGSAYNNKGKRKGTTRGMGAKSRKFINMYGFDPTDFSY
IRFVDPLTGHTIDESTNAPIDLVQHEFGKVRTRMLIDDEIEPQSLSTHTTIHAYLVNSGT
KKVLKVDLTPHSSLRASEKSTAIMGFPERENELRQTGMAVPVAYDQLPPKNEDLTFEGES
LFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGV
FKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSS
MVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVP
KNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEEPFQPVKEATQLMNELVYSQG
EKRKWVVEALSGNLRPVAECPSQLVTKHVVKGKCPLFELYLQLNPEKEAYFKPMMGAYKP
SRLNREAFLKDILKYASEIEIGNVDCDLLELAISMLVTKLKALGFPTVNYITDPEEIFSA
LNMKAAMGALYKGKKKEALSELTLDEQEAMLKASCLRLYTGKLGIWNGSLKAELRPIEKV
ENNKTRTFTAAPIDTLLAGKVCVDDFNNQFYDLNIKAPWTVGMTKFYQGWNELMEALPSG
WVYCDADGSQFDSSLTPFLINAVLKVRLAFMEEWDIGEQMLRNLYTEIVYTPILTPDGTI
IKKHKGNNSGQPSTVVDNTLMVIIAMLYTCEKCGINKEEIVYYVNGDDLLIAIHPDKAER
LSRFKESFGELGLKYEFDCTTRDKTQLWFMSHRALERDGMYIPKLEEERIVSILEWDRSK
EPSHRLEAICASMIEAWGYDKLVEEIRNFYAWVLEQAPYSQLAEEGKAPYLAETALKFLY
TSQHGTNSEIEEYLKVLYDYDIPTTENLYFQSGTVDAGADAGKKKDQKDDKVAEQASKDR
DVNAGTSGTFSVPRINAMATKLQYPRMRGEVVVNLNHLLGYKPQQIDLSNARATHEQFAA
WHQAVMTAYGVNEEQMKILLNGFMVWCIENGTSPNLNGTWVMMDGEDQVSYPLKPMVENA
QPTLRQIMTHFSDLAEAYIEMRNRERPYMPRYGLQRNITDMSLSRYAFDFYELTSKTPVR
AREAHMQMKAAAVRNSGTRLFGLDGNVGTAEEDTERHTAHDVNRNMHTLLGVRQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. LYFQ-SGTV.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. LYFQ-SGTV.

is proteolytically cut by potato virus Y-type helper component peptidase (C06.001) cleavage. YNVG-GMNR.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. VYSQ-GEKR.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. VYFQ-GKKN.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. IYLQ-SDSE.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. IYTQ-SLDD.

is proteolytically cut by tobacco etch virus NIa peptidase (C04.004) cleavage. KVFM-SKPE.