Collagen alpha-1(II) chain (Fragment)

UniProt : P02460, UniProt ID: CO2A1_CHICK,

Collagen alpha-1(II) chain (Fragment)

Gallus gallus

GETGEAGERGLKGHRGFTGLQGLPGPPGPSGDQGAAGPAGPSGPRGPPGPVGPSGKDGSN
GMPGPIGPPGPRGRSGEPGPAGPPGNPGPPGPPGPPGTGIDMSAFAGLGQTEKGPDPIRY
MRADEAAGGLRQHDVEVDATLKSLNNQIESIRSPEGSKKNPARTCRDIKLCHPEWKSGDY
WIDPNQGCTLDAIKVFCNMETGETCVYPTPSSIPRKNWWTSKTKDKKHVWFAETINGGFH
FSYGDENLSPNTASIQMTFLRLLSTEGSQNVTYHCKNSIAYMDEETGNLKKAILIQGSND
VEIRAEGNSRFTYSVLEDGCTKHTGKWGKTVIEYRSQKTSRLPIVDIAPMDIGGADQEFG
VDIGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(II) chain (Fragment) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragment) contains a PF01410 domain.

Collagen alpha-1(II) chain (Fragment) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragment) is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. YMRA-DEAA.