PMAP: SubstrateDB : Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA)

Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA)

UniProt : P01583, Q53QF9, UniProt ID: IL1A_HUMAN, Q53QF9_HUMAN,

Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA)

Homo sapiens

MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA) contains a PF00340 domain.

Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA) contains a PF02394 domain.

Putative uncharacterized protein IL1A (Interleukin 1, alpha) (cDNA, FLJ95747, Homo sapiens interleukin 1, alpha (IL1A), mRNA) is proteolytically cut by calpain-1 (C02.001) cleavage..