cDNA, FLJ95255, Homo sapiens nucleoporin 50kDa (NUP50), transcript variant 2, mRNA (HCG1989366, isoform CRA_a)

UniProt : B2RB15, Q9UKX7, UniProt ID: B2RB15_HUMAN, NUP50_HUMAN,

cDNA, FLJ95255, Homo sapiens nucleoporin 50kDa (NUP50), transcript variant 2, mRNA (HCG1989366, isoform CRA_a)

Homo sapiens

MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKG
FKGLVVPSGGGRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANG
PTTLVDKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPL
CDLTPIFKDYEKYLANIEQQHGNSGRNSESESNKVAAETQSPSLFGSTKLQQESTFLFHG
NKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNS
SLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYS
KKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95255, Homo sapiens nucleoporin 50kDa (NUP50), transcript variant 2, mRNA (HCG1989366, isoform CRA_a) contains a PF00638 domain.

cDNA, FLJ95255, Homo sapiens nucleoporin 50kDa (NUP50), transcript variant 2, mRNA (HCG1989366, isoform CRA_a) contains a PF08911 domain.

cDNA, FLJ95255, Homo sapiens nucleoporin 50kDa (NUP50), transcript variant 2, mRNA (HCG1989366, isoform CRA_a) is proteolytically cut by caspase () cleavage. TLVD-KVSN.