HMW glutenin subunit

UniProt : Q8GV12, UniProt ID: Q8GV12_WHEAT,

HMW glutenin subunit

Triticum aestivum

MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVMDQQLRDISPE
CHPVVVSPVAGQYEQQIVMPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTSPQ
QVSYYPGQASPQRPGQGQQPGQGQQSGQGQQGYYPTSPQQPGQWQQPEQGQPGYYPTSPQ
QPGQLQQPAQGQQPGQGQQGRQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQG
QQPGQGQQPGQGQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSL
QQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQGQQGQQPGQGQQP
GQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQL
GQGQPGYYPTSPLQSGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQG
QQGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQG
QQAQQPGQGQQPGQGQPGYYPTSPLQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKG
QQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQQPGQWQQPGQGQPG
YYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQG
QQPAQGQQGQQLGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYYP
TSPQESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQPGQGQQP
GQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSPQQSGQGQQLGQWLQP
GQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCR
LEGGDALSASQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

HMW glutenin subunit contains a PF03157 domain.

HMW glutenin subunit is proteolytically cut by trypsin 1 (S01.127) cleavage..

HMW glutenin subunit is proteolytically cut by pepsin A (A01.001) cleavage..

HMW glutenin subunit is proteolytically cut by chymotrypsin B (S01.152) cleavage..

HMW glutenin subunit is proteolytically cut by pancreatic elastase II (S01.155) cleavage..

HMW glutenin subunit is proteolytically cut by carboxypeptidase A1 (M14.001) cleavage..