Bcl-2-like protein 11

UniProt : O43521, UniProt ID: BIM_HUMAN,

Bcl-2-like protein 11

Homo sapiens

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bcl-2-like protein 11 contains a PF06773 domain.

Bcl-2-like protein 11 contains a PF08945 domain.

Bcl-2-like protein 11 is proteolytically cut by caspase-3 (C14.003) cleavage. SECD-REGR.