Pro-MCH
|
Pro-MCH Rattus norvegicus MAKMSLSSYMLMLAFSLFSHGILLSASKSIRNVEDDIVFNTFRMGKAFQKEDTAERSVVA PSLEGYKNDESGFMKDDDDKTTKNTGSKQNLVTHGLPLSLAVKPYLALKGPAVFPAENGV QNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Pro-MCH contains a PF05824 domain.
Pro-MCH is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. IGRR-DFDM.
Pro-MCH is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. QEKR-EIGD.
Pro-MCH is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. IGRR-DFDM.