Pro-melanin-concentrating hormone

UniProt : Q8WVG0, UniProt ID: Q8WVG0_HUMAN,

Pro-melanin-concentrating hormone

Homo sapiens

MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIA
PSLEQYKNDESSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGV
QNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pro-melanin-concentrating hormone contains a PF05824 domain.

Pro-melanin-concentrating hormone is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. PIGR-RDFD.