Murine coronavirus (strain A59)

MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRV
NCSRLPALECCVQSAIIRDIFVDEDPQKVEASTMMALQFGSAVLVKPSKRLSIQAWTNLG
VLPKTAAMGLFKRVCLCNTRECSCDAHVAFHLFTVQPDGVCLGNGRFIGWFVPVTAIPEY
AKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSCKAYA
LLKGYRGVKPILFVDQYGCDYTGCLAKGLEDYGDLTLSEMKELFPVWRDSLDSEVLVAWH
VDRDPRAAMRLQTLATVRCIDYVGQPTEDVVDGDVVVREPAHLLAANAIVKRLPRLVETM
LYTDSSVTEFCYKTKLCECGFITQFGYVDCCGDTCDFRGWVAGNMMDGFPCPGCTKNYMP
WELEAQSSGVIPEGGVLFTQSTDTVNRESFKLYGHAVVPFGSAVYWSPCPGMWLPVIWSS
VKSYSGLTYTGVVGCKAIVQETDAICRSLYMDYVQHKCGNLEQRAILGLDDVYHRQLLVN
RGDYSLLLENVDLFVKRRAEFACKFATCGDGLVPLLLDGLVPRSYYLIKSGQAFTSMMVN
FSHEVTDMCMDMALLFMHDVKVATKYVKKVTGKLAVRFKALGVAVVRKITEWFDLAVDIA
ASAAGWLCYQLVNGLFAVANGVITFVQEVPELVKNFVDKFKAFFKVLIDSMSVSILSGLT
VVKTASNRVCLAGSKVYEVVQKSLSAYVMPVGCSEATCLVGEIEPAVFEDDVVDVVKAPL
TYQGCCKPPTSFEKICIVDKLYMAKCGDQFYPVVVDNDTVGVLDQCWRFPCAGKKVEFND
KPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPC
KEHDVIGTKVCALLDRLAGDYVYLFDEGGDEVIAPRMYCSFSAPDDEDCVAADVVDADEN
QDDDAEDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEELAEPDAVGSQTPIASAEE
TEVGEASDREGIAEAKATVCADAVDACPDQVEAFEIEKVEDSILDELQTELNAPADKTYE
DVLAFDAVCSEALSAFYAVPSDETHFKVCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDL
EMQKLWLSYKAGYDQCFVDKLVKSVPKSIILPQGGYVADFAYFFLSQCSFKAYANWRCLE
CDMELKLQGLDAMFFYGDVVSHMCKCGNSMTLLSADIPYTLHFGVRDDKFCAFYTPRKVF
RAACAVDVNDCHSMAVVEGKQIDGKVVTKFIGDKFDFMVGYGMTFSMSPFELAQLYGSCI
TPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKAQ
GVCQVGECYESAGGKLCKKVLNIVGPDARGHGKQCYSLLERAYQHINKCDNVVTTLISAG
IFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCRDV
KFVTNACSSLFSESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDCLPTDWRLVNKF
DSVDGVRTIKYFECPGGIFVSSQGKKFGYVQNGSFKEASVSQIRALLANKVDVLCTVDGV
NFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEADLVAVKDAFG
FDEPQLLKYYTMLGMCKWPVVVCGNYFAFKQSNNNCYINVACLMLQHLSLKFPKWQWQEA
WNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCNLEFVCKCGVKQ
EQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLVHCTQFNVPFLICSNTPEGRKLPDDV
VAANIFTGGSVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCLYLKNLKQTFSSVLTT
FYLDDVKCVEYKPDLSQYYCESGKYYTKPIIKAQFRTFEKVDGVYTNFKLVGHSIAEKLN
AKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGCITFGKPVVWLGHEEASLK
SLTYFNRPSVVCENKFNVLPVDVSEPTDKGPVPAAVLVTGVPGADASAGAGIAKEQKACA
SASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSVVVNDPTSETKVVKSLSIVD
VYDMFLTGCKYVVWTANELSRLVNSPTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKV
VKAKAIACYCAVKWFLLYCFSWIKFNTDNKVIYTTEVASKLTFKLCCLAFKNALQTFNWS
VVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDF
YQVTDLGYRSSFCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDYISLFKLVVEL
VIGYSLYTVCFYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYI
VVTAMYKVYCLCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFC
TKHQWNCLNCNSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFY
ERDGQRVYDDVNASLFVDMNGLLHSKVKGVPETHVVVVENEADKAGFLGAAVFYAQSLYR
PMLMVEKKLITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLE
QVMDTFIGCARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAA
DLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNK
QEANVPILTTPFSLKGGAVFSRMLQWLFVANLICFIVLWALMPTYAVHKSDMQLPLYASF
KVIDNGVLRDVSVTDACFANKFNQFDQWYESTFGLAYYRNSKACPVVVAVIDQDIGHTLF
NVPTTVLRYGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGT
PHPYCYTGGVMHNASLYSSLAPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVG
LCEEAEEGICFNFNRSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVRPIDFFALTASS
VAGAILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYAC
FYFYTTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVVSNHALWLFSYCRKIGTEV
RSDGTFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAAC
SQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCIVSVTYGNMTL
NGLWLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSGRMSLTVMSYQMQGCQL
VLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGS
VGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAW
LYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLVLDALASMTGVTVEQVLAAIK
RLHSGFQGKQILGSCVLEDETPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLFCSII
SAFVKWTMFMYVTTHMLGVTLCALCFVSFAMLLIKHKHLYLTMYIMPVLCTFYTNYLVVY
KQSFRGLAYAWLSHFVPAVDYTYMDEVLYGVVLLVAMVFVTMRSINHDVFSIMFLVGRLV
SLVSMWYFGANLEEEVLLFLTSLFGTYTWTTMLSLATAKVIAKWLAVNVLYFTDVPQIKL
VLLSYLCIGYVCCCYWGILSLLNSIFRMPLGVYNYKISVQELRYMNANGLRPPRNSFEAL
MLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSKLWQYCSTLHNEI
LATSDLSMAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTVLQALQSEFVNMA
SFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVARKLERMADLALTN
MYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPLNAIPSLTSNTLT
IIVPDKQVFDQVVDNVYVTYAGNVWHIQFIQDADGAVKQLNEIDVNSTWPLVIAANRHNE
VSTVVLQNNELMPQKLRTQVVNSGSDMNCNTPTQCYYNTTGTGKIVYAILSDCDGLKYTK
IVKEDGNCVVLELDPPCKFSVQDVKGLKIKYLYFVKGCNTLARGWVVGTLSSTVRLQAGT
ATEYASNSAILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKMLCDHAGTGMAITIKPEATT
NQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLGIKDPVSYVLTHDVCQVCGFWR
DGSCSCVGTGSQFQSKDTNFLNRIRGTSVNARLVPCASGLDTDVQLRAFDICNANRAGIG
LYYKVNCCRFQRVDEDGNKLDKFFVVKRTNLEVYNKEKECYELTKECGVVAEHEFFTFDV
EGSRVPHIVRKDLSKFTMLDLCYALRHFDRNDCSTLKEILLTYAECEESYFQKKDWYDFV
ENPDIINVYKKLGPIFNRALLNTAKFADALVEAGLVGVLTLDNQDLYGQWYDFGDFVKTV
PGCGVAVADSYYSYMMPMLTMCHALDSELFVNGTYREFDLVQYDFTDFKLELFTKYFKHW
SMTYHPNTCECEDDRCIIHCANFNILFSMVLPKTCFGPLVRQIFVDGVPFVVSIGYHYKE
LGVVMNMDVDTHRYRLSLKDLLLYAADPALHVASASALLDLRTCCFSVAAITSGVKFQTV
KPGNFNQDFYEFILSKGLLKEGSSVDLKHFFFTQDGNAAITDYNYYKYNLPTMVDIKQLL
FVLEVVNKYFEIYEGGCIPATQVIVNNYDKSAGYPFNKFGKARLYYEALSFEEQDEIYAY
TKRNVLPTLTQMNLKYAISAKNRARTVAGVSILSTMTGRMFHQKCLKSIAATRGVPVVIG
TTKFYGGWDDMLRRLIKDVDSPVLMGWDYPKCDRAMPNILRIVSSLVLARKHDSCCSHTD
RFYRLANECAQVLSEIVMCGGCYYVKPGGTSSGDATTAFANSVFNICQAVSANVCSLMAC
NGHKIEDLSIRELQKRLYSNVYRADHVDPAFVSEYYEFLNKHFSMMILSDDGVVCYNSEF
ASKGYIANISAFQQVLYYQNNVFMSEAKCWVETDIEKGPHEFCSQHTMLVKMDGDEVYLP
YPDPSRILGAGCFVDDLLKTDSVLLIERFVSLAIDAYPLVYHENPEYQNVFRVYLEYIKK
LYNDLGNQILDSYSVILSTCDGQKFTDETFYKNMYLRSAVLQSVGACVVCSSQTSLRCGS
CIRKPLLCCKCAYDHVMSTDHKYVLSVSPYVCNSPGCDVNDVTKLYLGGMSYYCEDHKPQ
YSFKLVMNGMVFGLYKQSCTGSPYIEDFNKIASCKWTEVDDYVLANECTERLKLFAAETQ
KATEEAFKQCYASATIREIVSDRELILSWEIGKVRPPLNKNYVFTGYHFTNNGKTVLGEY
VFDKSELTNGVYYRATTTYKLSVGDVFILTSHAVSSLSAPTLVPQENYTSIRFASVYSVP
ETFQNNVPNYQHIGMKRYCTVQGPPGTGKSHLAIGLAVYYCTARVVYTAASHAAVDALCE
KAHKFLNINDCTRIVPAKVRVDCYDKFKVNDTTRKYVFTTINALPELVTDIIVVDEVSML
TNYELSVINSRVRAKHYVYIGDPAQLPAPRVLLNKGTLEPRYFNSVTKLMCCLGPDIFLG
TCYRCPKEIVDTVSALVYNNKLKAKNDNSSMCFKVYYKGQTTHESSSAVNMQQIHLISKF
LKANPSWSNAVFISPYNSQNYVAKRVLGLQTQTVDSAQGSEYDFVIYSQTAETAHSVNVN
RFNVAITRAKKGILCVMSSMQLFESLNFTTLTLDKINNPRLQCTTNLFKDCSRSYVGYHP
AHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGFKLDLTLDGYCKLFITRDEA
IKRVRAWVGFDAEGAHAIRDSIGTNFPLQLGFSTGIDFVVEATGMFAERDGYVFKKAAAR
APPGEQFKHLIPLMSRGQKWDVVRIRIVQMLSDHLVDLADSVVLVTWAASFELTCLRYFA
KVGREVVCSVCTKRATCFNSRTGYYGCWRHSYSCDYLYNPLIVDIQQWGYTGSLTSNHDP
ICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIISNEVSVNTSCRLLQRVMFRA
AMLCNRYDVCYDIGNPKGLACVKGYDFKFYDASPVVKSVKQFVYKYEAHKDQFLDGLCMF
WNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLYVNKHAFHTSPFTRAAFENLKPMPF
FYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLGGAVCLKHAEEYREYLESYNTATTA
GFTFWVYKTFDFYNLWNTFTRLQSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQN
EDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSS
TYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLN
GVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHYRSPQGNPGGNRVGDLSGNEALA
RGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLH
LLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSL
NLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTFYPRLQAAADWKPGYVMPVLYKYLESPLE
RVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDKGVAPGSA
VLRQWLPAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQWDLIISDMYDPLTKNIGEYN
VSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAELYSLMGKFAFWTIFCTNVNASSSE
GFLIGINWLNKTRTEIDGKTMHANYLFWRNSTMWNGGAYSLFDMSKFPLKAAGTAVVSLK
PDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVNVK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. AVLQ-SVGA.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. SQFQ-SKDT.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. VRLQ-AGTA.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. VVLQ-NNEL.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. QALQ-SEFV.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. VKLQ-SKRT.

is proteolytically cut by hepatitis coronavirus picornain 3C-like peptidase (C30.001) cleavage. SFLQ-SGIV.