Collagen alpha-1(II) chain (Fragments)

UniProt : P02459, UniProt ID: CO2A1_BOVIN,

Collagen alpha-1(II) chain (Fragments)

Bos taurus

ZMGZGFBZKGAGAAMGVMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPP
GPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAP
GVKGESGSPGZBGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGP
GFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAAGNPGTDGIPGAKGSAGAP
GIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGVQGAPGPA
GEEGKRGARGEPGGAGPAGPPGERGAPGSRGFPGQDGIAGPKGPPGERGSPGAVGPKGSP
GEAGRPGEAGLPGAKGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFP
GPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQ
GLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTP
GTDGPKGASGPAGPPGAQGPPGLQGMTLDAMKVFCNMETGETCVYPNPASVPKKNWWSSK
SKDKKHIWFGETINGGFHFSYGDDNLAPNTADVQMTFLRLLSTEGSQNITYHCKNSIAYL
DEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTKHTGKWGKTMIEYRSQKTSRL
PIIDIAPMDIGGPEQEFGVDIGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01410 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) contains a PF01391 domain.

Collagen alpha-1(II) chain (Fragments) is proteolytically cut by cathepsin K (C01.036) cleavage. GKPG-KSGE.

Collagen alpha-1(II) chain (Fragments) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AGGA-QMGA.