cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a)

UniProt : A8K8Q1, Q92667, UniProt ID: A8K8Q1_HUMAN, AKAP1_HUMAN,

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a)

Homo sapiens

MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPV
EDVCPKVVSTPPSVTEPPEKELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLR
PGTRRDDSTKLELALTGGEAKSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPRKVQP
GYPVVPAEKRSSGERARETGGAEGTGDAVLGEKVLEEALLSREHVLELENSKGPSLASLE
GEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGV
EGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEAT
EQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGPDTAEPATAEAAVAPPDAGLP
LPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGI
LVEDATCVTCMSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPEST
VPFSNGVLKGELSDLGAEDGWTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGS
NPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQICHIEGS
QHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNA
GHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVV
ASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSP
EADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYY
TSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) contains a PF00567 domain.

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) contains a PF00013 domain.

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSVD-SCCS.

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) is proteolytically cut by caspase-8 (C14.009) cleavage. DSVD-SCCS.

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) is proteolytically cut by caspase-10 (C14.011) cleavage. DSVD-SCCS.

cDNA FLJ77438, highly similar to Homo sapiens A kinase (PRKA) anchor protein 1 (AKAP1), transcript variant 1, mRNA (A kinase (PRKA) anchor protein 1, isoform CRA_a) is proteolytically cut by caspase-2 (C14.006) cleavage. DSVD-SCCS.