Coagulation factor IX

UniProt : P00741, UniProt ID: FA9_BOVIN,

Coagulation factor IX

Bos taurus

YNSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGG
MCKDDINSYECWCQAGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAED
QKSCEPAVPFPCGRVSVSHISKKLTRAETIFSNTNYENSSEAEIIWDNVTQSNQSFDEFS
RVVGGEDAERGQFPWQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTE
KPEPTEQKRNVIRAIPYHSYNASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIF
SKFGYGYVSGWGKVFNRGRSASILQYLKVPLVDRATCLRSTKFSIYSHMFCAGYHEGGKD
SCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulation factor IX contains a PF00008 domain.

Coagulation factor IX contains a PF00008 domain.

Coagulation factor IX contains a PF00089 domain.

Coagulation factor IX contains a PF00594 domain.

Coagulation factor IX is proteolytically cut by coagulation factor XIa (S01.213) cleavage. EFSR-VVGG.

Coagulation factor IX is proteolytically cut by coagulation factor XIa (S01.213) cleavage. KLTR-AETI.