Vitamin K-dependent protein C (Fragment)

UniProt : P00745, UniProt ID: PROC_BOVIN,

Vitamin K-dependent protein C (Fragment)

Bos taurus

XTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLRIRKRANSFLEELRPGNVERECSEEV
CEFEEAREIFQNTEDTMAFWSFYSDGDQCEDRPSGSPCDLPCCGRGKCIDGLGGFRCDCA
EGWEGRFCLHEVRFSNCSAENGGCAHYCMEEEGRRHCSCAPGYRLEDDHQLCVSKVTFPC
GRLGKRMEKKRKTLKRDTNQVDQKDQLDPRIVDGQEAGWGESPWQAVLLDSKKKLVCGAV
LIHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWEVDLDIKEVIIHPNYTKSTSDNDIA
LLRLAKPATLSQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRDETKRNRTFVLSFIKV
PVVPYNACVHAMENKISENMLCAGILGDPRDACEGDSGGPMVTFFRGTWFLVGLVSWGEG
CGRLYNYGVYTKVSRYLDWIYGHIKAQEAPLESQVP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Vitamin K-dependent protein C (Fragment) contains a PF00008 domain.

Vitamin K-dependent protein C (Fragment) contains a PF00008 domain.

Vitamin K-dependent protein C (Fragment) contains a PF00594 domain.

Vitamin K-dependent protein C (Fragment) contains a PF00089 domain.

Vitamin K-dependent protein C (Fragment) is proteolytically cut by coagulation factor Xa (S01.216) cleavage..